PEN2 (PSENEN) (NM_172341) Human Mass Spec Standard

CAT#: PH303272

PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844)

Product Images

Coomassie blue staining of purified PSENEN protein (Cat# TP303272). The protein was produced from HEK293T cells transfected with PSENEN cDNA clone (Cat# RC203272) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203272
• Predicted MW: 12 kDa
• Protein Sequence:
  Sequence Link

  >RC203272 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIV
  LTSWITIFQIYRPRWGALGDYLSFTIPLGTP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_758844
• RefSeq Size: 834
• RefSeq ORF: 303
• Synonyms: ACNINV2; MDS033; MSTP064; PEN-2; PEN2
• Locus ID: 55851
• UniProt ID: Q9NZ42
• Cytogenetics: 19q13.12
• Summary: Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Alzheimer's disease, Notch signaling pathway