Germany
Japan
United Kingdom
China
Products
Rabbit polyclonal antibody to RALB (v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALB (Uniprot ID#P11234) |
Rabbit polyclonal Anti-RALB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RALB antibody: synthetic peptide directed towards the middle region of human RALB. Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE |
Anti-RALB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 142-156 amino acids of Human Ras-related protein Ral-B |
Ralb Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse Ralb |
RALB Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-206 of human RALB (NP_002872.1). |
| Modifications | Unmodified |
RALB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-206 of human RALB (NP_002872.1). |
| Modifications | Unmodified |
Active filters
Category
-
- Antibodies
-
-
-
Target Symbol
- RALB