Products

cDNA Clones (18)
Antibodies (11)
Proteins (8)
RNAi (8)
Gene Expression (7)
Jump to Filters
View as table Download
SOX1 Rabbit Polyclonal Antibody
TA321738

USD 345.00

In Stock

Anti-SOX1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 378-391 amino acids of human SRY (sex determining region Y)-box 1
SOX1 Rabbit Polyclonal Antibody
TA318969

USD 355.00

3 Weeks

Rabbit polyclonal anti-Sox-1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 322 of mouse Sox-1
SOX1 Rabbit Polyclonal Antibody
TA329398

USD 375.00

5 Days

Rabbit Polyclonal anti-SOX1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the middle region of human SOX1. Synthetic peptide located within the following region: AAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPC
SOX1 Rabbit Polyclonal Antibody
TA335703

USD 375.00

5 Days

Rabbit Polyclonal Anti-SOX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX1 Antibody: synthetic peptide directed towards the N terminal of human SOX1. Synthetic peptide located within the following region: YSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRV
SOX1 Rabbit Polyclonal Antibody
TA335704

USD 375.00

5 Days

Rabbit Polyclonal Anti-SOX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX1 Antibody: synthetic peptide directed towards the C terminal of human SOX1. Synthetic peptide located within the following region: ALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAA
SOX1 Rabbit Polyclonal Antibody
TA343572

USD 375.00

5 Days

Rabbit Polyclonal Anti-SOX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the N terminal of human SOX1. Synthetic peptide located within the following region: GGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK
SOX1 Rabbit Polyclonal Antibody
TA343573

USD 375.00

5 Days

Rabbit Polyclonal Anti-SOX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX1 antibody: synthetic peptide directed towards the middle region of human SOX1. Synthetic peptide located within the following region: REMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTH
SOX1 Rabbit Polyclonal Antibody
TA354596

USD 355.00

5 Days

Rabbit anti SOX-1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide derived from N-terminus of Human SOX-1 protein. This sequence is identical among human and mouse.
SOX1 Rabbit Polyclonal Antibody
TA321737

USD 345.00

In Stock

Anti-SOX1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 378-391 amino acids of human SRY (sex determining region Y)-box 1
SOX1 Rabbit Polyclonal Antibody
TA355489

USD 360.00

5 Days

SOX1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human SOX1
SOX1 Rabbit Polyclonal Antibody
TA381886

USD 220.00

3 Weeks

SOX1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human SOX1
Modifications Unmodified