SOX1 Rabbit Polyclonal Antibody

CAT#: TA335704

Rabbit Polyclonal Anti-SOX1 Antibody

Product Images

WB Suggested Anti-SOX1 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SOX1 Antibody: synthetic peptide directed towards the C terminal of human SOX1. Synthetic peptide located within the following region: ALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: SRY-box 1
• Database Link:
  NP_005977
  Entrez Gene 6656 Human
  UniProt ID O00570
• Background: SOX1 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. SOX1 may act as a transcriptional activator after forming a protein complex with other proteins. In mice, a similar protein regulates the gamma-crystallin genes and is essential for lens development.
• Synonyms: SRY (sex determining region Y)-box 1; SRY-related HMG-box gene 1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%

Reference Data

• Protein Families: Adult stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transmembrane