Products

cDNA Clones (46)
Proteins (18)
RNAi (13)
Gene Expression (8)
Antibodies (5)
Jump to Filters
View as table Download
STK16 Rabbit Polyclonal Antibody
TA346579

USD 475.00

5 Days

Rabbit Polyclonal Anti-STK16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL
STK16 Mouse Monoclonal Antibody [Clone ID: M2]
AM20962PU-N

USD 480.00

2 Weeks

STK16 mouse monoclonal antibody, clone M2, Purified

Applications ELISA, IHC, RNAi, WB
Reactivities Human
STK16 Rabbit Polyclonal Antibody
TA350459

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK16 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STK16
STK16 Rabbit Polyclonal Antibody
TA365045

USD 380.00

4 Weeks

STK16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STK16
STK16 Rabbit Polyclonal Antibody
TA382123

USD 220.00

3 Weeks

STK16 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-305 of human STK16 (NP_001008910.1).
Modifications Unmodified