Products

cDNA Clones (7)
Proteins (5)
Gene Expression (3)
RNAi (3)
Antibodies (1)
Jump to Filters
View as table Download
T2R50 (TAS2R50) Rabbit Polyclonal Antibody
TA333440

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAS2R50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R50. Synthetic peptide located within the following region: PFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLL