T2R50 (TAS2R50) Rabbit Polyclonal Antibody

CAT#: TA333440

Rabbit Polyclonal Anti-TAS2R50 Antibody

Product Images

WB Suggested Anti-TAS2R50 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TAS2R50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R50. Synthetic peptide located within the following region: PFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: taste 2 receptor member 50
• Database Link:
  NP_795371
  Entrez Gene 259296 Human
  UniProt ID P59544
• Background: TAS2R50 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway.
• Synonyms: T2R50; T2R51; TAS2R51
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Taste transduction