Germany
Japan
United Kingdom
China
Products
TNFSF18 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human TNFSF18 |
Anti-Human AITRL Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human AITRL |
Rabbit Polyclonal Anti-TNFSF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF18 antibody: synthetic peptide directed towards the middle region of human TNFSF18. Synthetic peptide located within the following region: KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN |
Recombinant Anti-GITRL (Clone YGL386)
| Applications | ELISA, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-GITRL (Clone YGL386)
| Applications | ELISA, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Recombinant Anti-GITR (Clone YGITR765)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-GITR (Clone YGITR765)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Category
-
- Antibodies
-
-
-
-
Target Symbol
- TNFSF18
Filter by
Antibody Hosts
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)