Products

View as table Download

Rabbit Polyclonal Anti-SFRS10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the N terminal of human SFRS10. Synthetic peptide located within the following region: MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKS

Rabbit Polyclonal Anti-SFRS10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the middle region of human SFRS10. Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

TRA2B (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 207-237 amino acids from the Central region of human TRA2B

TRA2B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRA2B