Germany
Japan
United Kingdom
China
TRA2B (Myc-DDK-tagged)-Human transformer 2 beta homolog (Drosophila) (TRA2B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human transformer 2 beta homolog (Drosophila) (TRA2B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, TRA2B (Myc-DDK tagged) - Human transformer 2 beta homolog (Drosophila) (TRA2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TRA2B (mGFP-tagged) - Human transformer 2 beta homolog (Drosophila) (TRA2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TRA2B (GFP-tagged) - Human transformer 2 beta homolog (Drosophila) (TRA2B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRA2B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401542 is the updated version of KN201542.
Tra2b (GFP-tagged) - Mouse splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila) (Sfrs10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tra2b (Myc-DDK-tagged) - Mouse transformer 2 beta homolog (Drosophila) (Tra2b)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tra2b (Myc-DDK-tagged) - Mouse transformer 2 beta homolog (Drosophila) (Tra2b)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tra2b (Myc-DDK-tagged) - Mouse transformer 2 beta homolog (Drosophila) (Tra2b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tra2b (mGFP-tagged) - Mouse transformer 2 beta homolog (Drosophila) (Tra2b)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tra2b (GFP-tagged) - Mouse transformer 2 beta homolog (Drosophila) (Tra2b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human transformer 2 beta homolog (Drosophila) (TRA2B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TRA2B (Myc-DDK tagged) - Human transformer 2 beta homolog (Drosophila) (TRA2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human transformer 2 beta homolog (Drosophila) (TRA2B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TRA2B (mGFP-tagged) - Human transformer 2 beta homolog (Drosophila) (TRA2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TRA2B (Myc-DDK tagged) - Homo sapiens transformer 2 beta homolog (Drosophila) (TRA2B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TRA2B (GFP-tagged) - Homo sapiens transformer 2 beta homolog (Drosophila) (TRA2B), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tra2b (Myc-DDK-tagged ORF) - Rat splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila) (Sfrs10), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tra2b (Myc-DDK-tagged ORF) - Rat splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila) (Sfrs10), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tra2b (Myc-DDK-tagged ORF) - Rat splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila) (Sfrs10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tra2b (mGFP-tagged ORF) - Rat splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila) (Sfrs10), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tra2b (GFP-tagged ORF) - Rat splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila) (Sfrs10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tra2b (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit Polyclonal Anti-SFRS10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the N terminal of human SFRS10. Synthetic peptide located within the following region: MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKS |
Rabbit Polyclonal Anti-SFRS10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the middle region of human SFRS10. Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD |
Lenti ORF clone of Human transformer 2 beta homolog (Drosophila) (TRA2B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TRA2B (untagged)-Human transformer 2 beta homolog (Drosophila) (TRA2B)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Tra2b (untagged) - Mouse transformer 2 beta homolog (Drosophila) (Tra2b), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TRA2B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human transformer 2 beta homolog (Drosophila) (TRA2B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TRA2B (untagged)-Human transformer 2 beta homolog (Drosophila) (TRA2B)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TRA2B - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
TRA2B (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 207-237 amino acids from the Central region of human TRA2B |
Transient overexpression lysate of transformer 2 beta homolog (Drosophila) (TRA2B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TRA2B CRISPRa kit - CRISPR gene activation of human transformer 2 beta homolog
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Tra2b CRISPRa kit - CRISPR gene activation of mouse transformer 2 beta
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SFRS10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene TRA2B
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
TRA2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
qPCR primer pairs and template standards against Mus musculus gene Sfrs10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Tra2b
TRA2B MS Standard C13 and N15-labeled recombinant protein (NP_004584)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Tra2b (untagged ORF) - Rat splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila) (Sfrs10), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TRA2B (untagged) - Homo sapiens transformer 2 beta homolog (Drosophila) (TRA2B), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Tra2b (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
TRA2B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRA2B |
Transient overexpression of TRA2B (NM_004593) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TRA2B (NM_001243879) in HEK293T cells paraffin embedded controls for ICC/IHC staining
TRA2B - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- TRA2B