TRA2B (NM_004593) Human Mass Spec Standard

CAT#: PH301542

TRA2B MS Standard C13 and N15-labeled recombinant protein (NP_004584)

Product Images

Coomassie blue staining of purified TRA2B protein (Cat# TP301542). The protein was produced from HEK293T cells transfected with TRA2B cDNA clone (Cat# RC201542) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201542
• Predicted MW: 33.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201542 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR
  SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK
  YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR
  PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS
  RSYSPRRY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004584
• RefSeq Size: 4290
• RefSeq ORF: 864
• Synonyms: Htra2-beta; PPP1R156; SFRS10; SRFS10; TRA2-BETA; TRAN2B
• Locus ID: 6434
• UniProt ID: P62995
• Cytogenetics: 3q27.2
• Summary: 'This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]'
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome