TRA2B (NM_004593) Human Recombinant Protein

CAT#: TP301542

Recombinant protein of human transformer 2 beta homolog (Drosophila) (TRA2B)

Product Images

Coomassie blue staining of purified TRA2B protein (Cat# TP301542). The protein was produced from HEK293T cells transfected with TRA2B cDNA clone (Cat# RC201542) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201542 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSRRSSRRHYTR
  SRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYTTERDLREVFSK
  YGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR
  PTYGSSRRRDYYDRGYDRGYDDRDYYSRSYRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRS
  RSYSPRRY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004584
• Locus ID: 6434
• UniProt ID: P62995
• Cytogenetics: 3q27.2
• Refseq Size: 4290
• Refseq ORF: 864
• Synonyms: Htra2-beta; PPP1R156; SFRS10; SRFS10; TRA2-BETA; TRAN2B
• Summary: This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome