Products

cDNA Clones (8)
Antibodies (1)
Jump to Filters
View as table Download
CBS (NM_000071) Human Tagged ORF Clone
RC201755

USD 420.00

In Stock

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GNMT (NM_018960) Human Tagged ORF Clone
RC207497

USD 420.00

In Stock

GNMT (Myc-DDK-tagged)-Human glycine N-methyltransferase (GNMT)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Monoamine Oxidase A (MAOA) (NM_000240) Human Untagged Clone
SC126927

USD 310.00

In Stock

MAOA (untagged)-Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GLDC (NM_000170) Human Untagged Clone
SC120090

USD 1,100.00

In Stock

GLDC (untagged)-Human glycine dehydrogenase (decarboxylating) (GLDC), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
ALAS2 (NM_001037968) Human Untagged Clone
SC302946

USD 760.00

In Stock

ALAS2 (untagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CBS Rabbit Polyclonal Antibody
TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE