Germany
Japan
United Kingdom
China
SCD (Myc-DDK-tagged)-Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
FADS2 (Myc-DDK-tagged)-Human fatty acid desaturase 2 (FADS2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ACOT1 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 1 (ACOT1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
FADS1 (Myc-DDK-tagged)-Human fatty acid desaturase 1 (FADS1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SCD (untagged)-Human stearoyl-CoA desaturase (delta-9-desaturase) (SCD)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ELOVL2 (Myc-DDK-tagged)-Human ELOVL fatty acid elongase 2 (ELOVL2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-ELOVL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
Active filters
Pathways
- Biosynthesis of unsaturated fatty acids
Citations
- Yes