Products

Antibodies (1)
cDNA Clones (1)
Jump to Filters
View as table Download
ACSL3 (NM_004457) Human Tagged ORF Clone
RC208032

USD 420.00

In Stock

ACSL3 (Myc-DDK-tagged)-Human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI