Products

Antibodies (2)
RNAi (2)
Gene Expression (1)
cDNA Clones (1)
Jump to Filters
View as table Download
Angiopoietin 2 (ANGPT2) (NM_001118888) Human Tagged ORF Clone
RC225727

USD 420.00

In Stock

ANGPT2 (Myc-DDK-tagged)-Human angiopoietin 2 (ANGPT2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Angpt2 (C-term) Rabbit Polyclonal Antibody
AP23297PU-N

USD 330.00

2 Weeks

Angpt2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping near the C-terminal  (454-468) of Human Angiopoietin-2.
Angiopoietin 2 (ANGPT2) Rabbit Polyclonal Antibody
TA343276

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ANGPT2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG
ANGPT2 Human siRNA Oligo Duplex (Locus ID 285)
SR300199

USD 430.00

In Stock

ANGPT2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Angpt2 Mouse qPCR Primer Pair (NM_007426)
MP200672

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Angpt2

Angpt2 Mouse shRNA Plasmid (Locus ID 11601)
TR514004

USD 715.00

2 Weeks

Angpt2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS