Products

Antibodies (1)
RNAi (1)
cDNA Clones (1)
Jump to Filters
View as table Download
Mstn (NM_010834) Mouse Tagged ORF Clone
MR227629

USD 350.00

In Stock

Mstn (Myc-DDK-tagged) - Mouse myostatin (Mstn)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Myostatin Propeptide (MSTN) Rabbit Polyclonal Antibody
TA343358

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-MSTN Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN
Mstn Mouse shRNA Plasmid (Locus ID 17700)
TG512805

USD 715.00

In Stock

Mstn - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS