Products

View as table Download

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV

qSTAR qPCR primer pairs against Homo sapiens gene TUBB2A

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)