Germany
Japan
United Kingdom
China
TUBB2A (Myc-DDK-tagged)-Human tubulin, beta 2A (TUBB2A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, TUBB2A (Myc-DDK tagged) - Human tubulin, beta 2A (TUBB2A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TUBB2A (mGFP-tagged) - Human tubulin, beta 2A (TUBB2A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TUBB2A (GFP-tagged) - Human tubulin, beta 2A (TUBB2A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tubb2a (Myc-DDK-tagged) - Mouse tubulin, beta 2A (Tubb2a)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tubb2a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN518467 is the updated version of KN318467.
Tubb2a (GFP-tagged) - Mouse tubulin, beta 2a (Tubb2a)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tubb2a (Myc-DDK-tagged) - Mouse tubulin, beta 2A (Tubb2a)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tubb2a (Myc-DDK-tagged) - Mouse tubulin, beta 2A (Tubb2a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tubb2a (mGFP-tagged) - Mouse tubulin, beta 2A (Tubb2a)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tubb2a (GFP-tagged) - Mouse tubulin, beta 2A (Tubb2a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tubulin, beta 2A (TUBB2A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, TUBB2A (Myc-DDK tagged) - Human tubulin, beta 2A (TUBB2A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tubulin, beta 2A (TUBB2A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, TUBB2A (mGFP-tagged) - Human tubulin, beta 2A (TUBB2A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tubb2a (Myc-DDK-tagged ORF) - Rat tubulin, beta 2a (Tubb2a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tubb2a (Myc-DDK-tagged ORF) - Rat tubulin, beta 2a (Tubb2a), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tubb2a (Myc-DDK-tagged ORF) - Rat tubulin, beta 2a (Tubb2a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tubb2a (mGFP-tagged ORF) - Rat tubulin, beta 2a (Tubb2a), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tubb2a (GFP-tagged ORF) - Rat tubulin, beta 2a (Tubb2a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
qSTAR qPCR primer pairs against Homo sapiens gene TUBB2A
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
Tubb2a (untagged) - Mouse tubulin, beta 2A (Tubb2a), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TUBB2A (untagged)-Human tubulin, beta 2A (TUBB2A)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-Tubb2a Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tubb2a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tubb2a. Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE |
Lenti ORF clone of Human tubulin, beta 2A (TUBB2A), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TUBB2A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
TUBB2A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Tubb2a (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
TUBB2A - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of tubulin, beta 2A (TUBB2A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Tubb2a
Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TUBB2A CRISPRa kit - CRISPR gene activation of human tubulin beta 2A class IIa
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Tubb2a CRISPRa kit - CRISPR gene activation of mouse tubulin, beta 2A class IIA
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene TUBB2A
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene TUBB2A
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Tubb2a
| Application | Plasmid of exact quantity for transcript copy number calculation |
Tubb2a (untagged ORF) - Rat tubulin, beta 2a (Tubb2a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of tubulin beta 2A (TUBB2A) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
TUBB2A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBB2A |
TUBB2A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human TUBB2A |
TUBB2A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TUBB2A |
TUBB2A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TUBB2A |
Active filters
Target Symbol
- TUBB2A