GPX4 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GPX4 |
GPX4 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GPX4 |
Rabbit Polyclonal Anti-GPX4 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
Goat Polyclonal Antibody against GPX4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EEPLVIEKDLPHY, from the C Terminus of the protein sequence according to NP_002076.2; NP_001034937.1. |
Rabbit polyclonal Glutathione Peroxidase 4 antibody
Applications | WB |
Reactivities | Guinea Pig, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse GPx4 protein. |
GPX4 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-197 of human GPX4 (NP_002076.2). |
Modifications | Unmodified |