Products

View as table Download
CHM

USD 300.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli.
CHM

USD 450.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli.
CHM

USD 320.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human Rep1 produced in E. coli.
CHM

USD 450.00

In Stock

Goat Polyclonal Anti-REP1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 617 aa - stop at the C-terminus of human Rep1 produced in E. coli.

Rabbit Polyclonal Anti-CHM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM. Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE