Products

Jump to Filters
View as table Download
NR2F6 Rabbit Polyclonal Antibody
TA311673

USD 345.00

In Stock

Rabbit polyclonal anti-NR2F6 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6.
NR2F6 Rabbit Polyclonal Antibody
TA338164

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
NR2F6 (N-term) Rabbit Polyclonal Antibody
AP52933PU-N

USD 450.00

2 Weeks

NR2F6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-53 amino acids from the N-terminal region of human NR2F6
NR2F6 Rabbit Polyclonal Antibody
TA330216

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
NR2F6 Rabbit Polyclonal Antibody
TA330217

USD 310.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
NR2F6 Rabbit Polyclonal Antibody
TA332066

USD 310.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR2F6 Antibody: synthetic peptide directed towards the middle region of human NR2F6. Synthetic peptide located within the following region: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP
NR2F6 Rabbit Polyclonal Antibody
TA340518

USD 425.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Immunogen EAR2 / NR2F6 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR2F6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Pig, Platypus, Xenopus, Stickleback, Pufferfish, Zebrafish (100%); Opossum (94%).