Products

View as table Download

Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

PPP2R5D rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Synthetic peptide conjugated to KLH derived from the N-terminus of PP2A/B delta

Goat Polyclonal Antibody against PPP2R5D

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236.

Rabbit polyclonal anti-PPP2R5D antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D.