MAP2K7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAP2K7 |
MAP2K7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAP2K7 |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
Modifications | Phospho-specific |
MAP2K7 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP2K7 |
Rabbit polyclonal MAP2K7 (Thr275) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of threonine 275 (A-K-TP-R-S). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-MAP2K7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP2K7 antibody: synthetic peptide directed towards the middle region of human MAP2K7. Synthetic peptide located within the following region: ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL |
MAP2K7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAP2K7 |
Phospho-MEK7-S271/T275 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S271 & T275 of human MEK7 (NP_660186.1). |
Modifications | Phospho S271/T275 |