Products

View as table Download

MAP2K7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAP2K7

Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A).
Modifications Phospho-specific

MAP2K7 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAP2K7

Rabbit polyclonal MAP2K7 (Thr275) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of threonine 275 (A-K-TP-R-S).
Modifications Phospho-specific

Rabbit polyclonal anti-MAP2K7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP2K7 antibody: synthetic peptide directed towards the middle region of human MAP2K7. Synthetic peptide located within the following region: ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL

MAP2K7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAP2K7

Phospho-MEK7-S271/T275 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S271 & T275 of human MEK7 (NP_660186.1).
Modifications Phospho S271/T275