Rabbit polyclonal anti-P2RY13 antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human P2RY13. |
Rabbit polyclonal anti-P2RY13 antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human P2RY13. |
Rabbit Polyclonal Anti-P2RY13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RY13 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY13. Synthetic peptide located within the following region: YTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEK |
P2Y13 / P2RY13 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | P2Y13 / P2RY13 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human P2RY13 / P2Y13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Bat (94%); Dog, Pig (81%). |
P2Y13 / P2RY13 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | P2Y13 / P2RY13 antibody was raised against synthetic 17 amino acid peptide from 3rd extracellular domain of human P2RY13 / P2Y13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Elephant, Bovine, Rabbit (94%); Mouse, Bat, Horse (88%); Rat, Hamster, Dog, Chicken, Platypus (82%). |