Products

View as table Download

Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen PDE7B antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human PDE7B. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Gorilla, Mouse, Rat, Elephant, Horse, Rabbit (88%); Opossum (82%).

Rabbit Polyclonal Anti-PDE7B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE7B Antibody: synthetic peptide directed towards the middle region of human PDE7B. Synthetic peptide located within the following region: IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

PDE7B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 424-454 amino acids from the C-terminal region of Human PDE7B

Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Immunogen PDE7B antibody was raised against synthetic 18 amino acid peptide from internal region of human PDE7B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken (94%); Platypus (89%).

Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen PDE7B antibody was raised against synthetic 19 amino acid peptide from C-terminus of human PDE7B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset (95%).