Products

View as table Download

Rabbit polyclonal anti-UBE2D2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human UBE2D2.

Rabbit Polyclonal anti-EDG8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDG8 antibody: synthetic peptide directed towards the N terminal of human EDG8. Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

UBE2D2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 111-140 amino acids from the C-terminal region of human UBE2D2