Products

View as table Download

Rabbit Polyclonal Anti-MPO Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MPO

Rabbit Polyclonal Anti-MPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR

Rabbit polyclonal anti-Myeloperoxidase (MPO) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 765 of human MPO

Rabbit polyclonal Myeloperoxidase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Myeloperoxidase [Human Leukocytes]

Rabbit Polyclonal Myeloperoxidase Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Myeloperoxidase (MPO) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-310 of human Myeloperoxidase (MPO) (NP_000241.1).
Modifications Unmodified