Rabbit Polyclonal TCF12 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCF12 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCF12. |
Rabbit Polyclonal TCF12 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCF12 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human TCF12. |
Rabbit Polyclonal Anti-TCF12 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12. Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE |