USD 440.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Synthetic peptide |
USD 440.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Synthetic peptide |
Rabbit Polyclonal Anti-GNAI1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
USD 360.00
5 Days
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Peptide corresponding to amino acids 345 - 354 of Gialpha1 and 346-355 of Gialpha2. |
GNAI1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNAI1 |
GNAI1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNAI1 |
GNAI1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-354 of human GNAI1 (NP_002060.4). |
Modifications | Unmodified |