OIF (OGN) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 246-276 amino acids from the C-terminal region of Human Mimecan. |
OIF (OGN) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 246-276 amino acids from the C-terminal region of Human Mimecan. |
Rabbit Polyclonal Anti-Ogn Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ogn antibody is: synthetic peptide directed towards the C-terminal region of Rat Ogn. Synthetic peptide located within the following region: LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK |
OGN Antibody - N-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human OGN |
OGN Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-298 of human OGN (NP_148935.1). |
Modifications | Unmodified |