Ogn Rabbit Polyclonal Antibody

CAT#: TA346479

Rabbit Polyclonal Anti-Ogn Antibody

Product Images

Host: Rabbit; Target Name: Ogn; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ogn antibody is: synthetic peptide directed towards the C-terminal region of Rat Ogn. Synthetic peptide located within the following region: LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: osteoglycin
• Database Link:
  NP_001099573
  Entrez Gene 291015 Rat
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp586P2421; mimecan; OG; OIF; osteoglycin; SLRR3A
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Goat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%