Products

View as table Download

Rabbit Polyclonal Anti-ABHD17A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM108A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM108A1. Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI

ABHD17A Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of rat FAM108A