Germany
Japan
United Kingdom
China
FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Fam108a (Myc-DDK-tagged) - Mouse family with sequence similarity 108, member A (Fam108a)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
4 Weeks
Lenti ORF particles, ABHD17A (Myc-DDK tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, ABHD17A (mGFP-tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
FAM108A1 (GFP-tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABHD17A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN403884 is the updated version of KN203884.
Abhd17a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500656 is the updated version of KN300656.
Fam108a (GFP-tagged) - Mouse DNA segment, Chr 10, Brigham & Women's Genetics 1364 expressed (D10Bwg1364e)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fam108a (Myc-DDK-tagged) - Mouse family with sequence similarity 108, member A (Fam108a)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fam108a (Myc-DDK-tagged) - Mouse family with sequence similarity 108, member A (Fam108a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fam108a (mGFP-tagged) - Mouse family with sequence similarity 108, member A (Fam108a)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fam108a (GFP-tagged) - Mouse family with sequence similarity 108, member A (Fam108a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ABHD17A (Myc-DDK tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ABHD17A (mGFP-tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, FAM108A1 (Myc-DDK-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of FAM108A1 (mGFP-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, FAM108A1 (mGFP-tagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
FAM108A1 (GFP-tagged) - Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Fam108a1 (Myc-DDK-tagged ORF) - Rat family with sequence similarity 108, member A1 (Fam108a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fam108a1 (Myc-DDK-tagged ORF) - Rat family with sequence similarity 108, member A1 (Fam108a1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fam108a1 (Myc-DDK-tagged ORF) - Rat family with sequence similarity 108, member A1 (Fam108a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fam108a1 (mGFP-tagged ORF) - Rat family with sequence similarity 108, member A1 (Fam108a1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fam108a1 (GFP-tagged ORF) - Rat family with sequence similarity 108, member A1 (Fam108a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-ABHD17A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM108A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM108A1. Synthetic peptide located within the following region: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI |
Lenti ORF clone of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FAM108A1 (untagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
FAM108A1 (untagged)-ORIGENE UNIQUE VARIANT 1 of Human family with sequence similarity 108, member A1 (FAM108A1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Abhd17a (untagged) - Mouse family with sequence similarity 108, member A (Fam108a), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FAM108A1 (untagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
ABHD17A CRISPRa kit - CRISPR gene activation of human abhydrolase domain containing 17A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abhd17a CRISPRa kit - CRISPR gene activation of mouse abhydrolase domain containing 17A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene FAM108A1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ABHD17A
ABHD17A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene D10Bwg1364e
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Abhd17a
Fam108a1 (untagged ORF) - Rat family with sequence similarity 108, member A1 (Fam108a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of family with sequence similarity 108 member A1 (FAM108A1) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of family with sequence similarity 108 member A1 (FAM108A1) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
FAM108A1 (untagged)-Human family with sequence similarity 108, member A1 (FAM108A1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Abhd17a (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Abhd17a (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ABHD17A Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of rat FAM108A |
Active filters
Target Symbol
- ABHD17A