Rabbit polyclonal anti-ACOT4 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACOT4. |
Rabbit polyclonal anti-ACOT4 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACOT4. |
Rabbit Polyclonal Anti-ACOT4 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACOT4 antibody is: synthetic peptide directed towards the middle region of Human ACOT4. Synthetic peptide located within the following region: NALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH |