Products

cDNA Clones (25)
RNAi (10)
Proteins (7)
Gene Expression (6)
Antibodies (2)
Jump to Filters
View as table Download
Acot4 (NM_134247) Mouse Tagged ORF Clone
MR218697

USD 300.00

In Stock

Acot4 (Myc-DDK-tagged) - Mouse acyl-CoA thioesterase 4 (Acot4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Acyl coenzyme A Thioesterase 4 (ACOT4) Human Gene Knockout Kit (CRISPR)
KN410550

USD 1,290.00

2 Weeks

ACOT4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN410550 is the updated version of KN210550.
Acot4 Mouse Gene Knockout Kit (CRISPR)
KN500734

USD 1,290.00

2 Weeks

Acot4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN500734 is the updated version of KN300734.
Acot4 (NM_134247) Mouse Tagged ORF Clone
MG218697

USD 330.00

3 Weeks

Acot4 (GFP-tagged) - Mouse acyl-CoA thioesterase 4 (Acot4), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acot4 (NM_134247) Mouse Tagged ORF Clone
MR218697L3

USD 500.00

3 Weeks

Lenti ORF clone of Acot4 (Myc-DDK-tagged) - Mouse acyl-CoA thioesterase 4 (Acot4)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acot4 (NM_134247) Mouse Tagged ORF Clone
MR218697L4

USD 500.00

3 Weeks

Lenti ORF clone of Acot4 (mGFP-tagged) - Mouse acyl-CoA thioesterase 4 (Acot4)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acyl coenzyme A Thioesterase 4 (ACOT4) (NM_152331) Human Tagged ORF Clone Lentiviral Particle
RC210550L3V

USD 820.00

7 Weeks

Lenti ORF particles, ACOT4 (Myc-DDK tagged) - Human acyl-CoA thioesterase 4 (ACOT4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acot4 (NM_001109440) Rat Tagged ORF Clone
RR201259

USD 420.00

4 Weeks

Acot4 (Myc-DDK-tagged ORF) - Rat acyl-CoA thioesterase 4 (Acot4), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Acot4 (NM_001109440) Rat Tagged ORF Clone
RR201259L3

USD 640.00

10 Weeks

Lenti ORF clone of Acot4 (Myc-DDK-tagged ORF) - Rat acyl-CoA thioesterase 4 (Acot4), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acot4 (NM_001109440) Rat Tagged ORF Clone
RR201259L4

USD 700.00

10 Weeks

Lenti ORF clone of Acot4 (mGFP-tagged ORF) - Rat acyl-CoA thioesterase 4 (Acot4), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acyl coenzyme A Thioesterase 4 (ACOT4) Rabbit Polyclonal Antibody
TA316066

USD 345.00

In Stock

Rabbit polyclonal anti-ACOT4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACOT4.
Acyl coenzyme A Thioesterase 4 (ACOT4) Rabbit Polyclonal Antibody
TA344353

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACOT4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACOT4 antibody is: synthetic peptide directed towards the middle region of Human ACOT4. Synthetic peptide located within the following region: NALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH
Acyl coenzyme A Thioesterase 4 (ACOT4) (BC031799) Human Untagged Clone
SC122463

USD 660.00

In Stock

ACOT4 (untagged)-Homo sapiens, similar to peroxisomal acyl-CoA thioesterase 2B, clone MGC:25068 IMAGE:4498488, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Human Acyl coenzyme A Thioesterase 4 (ACOT4) activation kit by CRISPRa
GA114795

USD 1,290.00

2 Weeks

ACOT4 CRISPRa kit - CRISPR gene activation of human acyl-CoA thioesterase 4

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Acot4 activation kit by CRISPRa
GA212662

USD 1,290.00

2 Weeks

Acot4 CRISPRa kit - CRISPR gene activation of mouse acyl-CoA thioesterase 4

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Acot4 (NM_134247) Mouse Untagged Clone
MC212428

USD 420.00

5 Weeks

Acot4 (untagged) - Mouse acyl-CoA thioesterase 4 (Acot4), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Acot4 Mouse qPCR Primer Pair (NM_134247)
MP200295

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Acot4

Acot4 (NM_001109440) Rat Untagged Clone
RN201259

USD 420.00

6 Weeks

Acot4 (untagged ORF) - Rat acyl-CoA thioesterase 4 (Acot4), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Acyl coenzyme A Thioesterase 4 (ACOT4) (NM_152331) Human 3' UTR Clone
SC201939

USD 560.00

4 Weeks

3`UTR clone of acyl-CoA thioesterase 4 (ACOT4) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Acot4 Mouse siRNA Oligo Duplex (Locus ID 171282)
SR413957

USD 430.00

2 Weeks

Acot4 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Acyl coenzyme A Thioesterase 4 (ACOT4) (NM_152331) ICC Control Block
TB410550

USD 1,070.00

4 Weeks

Transient overexpression of ACOT4 (NM_152331) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Acot4 Mouse shRNA Plasmid (Locus ID 171282)
TL506156

USD 815.00

2 Weeks

Acot4 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Acot4 Mouse shRNA Lentiviral Particle (Locus ID 171282)
TL506156V

USD 1,395.00

5 Weeks

Acot4 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Acot4 Rat shRNA Plasmid (Locus ID 681337)
TL707932

USD 815.00

2 Weeks

Acot4 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Acot4 Rat shRNA Lentiviral Particle (Locus ID 681337)
TL707932V

USD 1,395.00

5 Weeks

Acot4 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Acot4 Mouse shRNA Plasmid (Locus ID 171282)
TR506156

USD 715.00

2 Weeks

Acot4 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Acot4 Rat shRNA Plasmid (Locus ID 681337)
TR707932

USD 715.00

2 Weeks

Acot4 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Acyl coenzyme A Thioesterase 4 (ACOT4) Cytosection
TS410550

USD 225.00

4 Weeks

Transient overexpression of ACOT4 (NM_152331) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Acyl coenzyme A Thioesterase 4 (ACOT4) Cytosection
TS410550P5

USD 889.00

4 Weeks

Transient overexpression of ACOT4 (NM_152331) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack