Products

View as table Download

Rabbit Polyclonal Anti-Arpc5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Arpc5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Arpc5. Synthetic peptide located within the following region: VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN

p16-ARC/ARC16/ARPC5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human p16-ARC/ARC16/p16-ARC/ARC16/ARPC5 (NP_001257368.1).
Modifications Unmodified