Germany
Japan
United Kingdom
China
ARPC5 (Myc-DDK-tagged)-Human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,020.00
3 Weeks
Lenti ORF particles, ARPC5 (Myc-DDK tagged) - Human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Arpc5 (Myc-DDK-tagged) - Mouse actin related protein 2/3 complex, subunit 5 (Arpc5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARPC5 (GFP-tagged) - Human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARPC5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN412631 is the updated version of KN212631.
Arpc5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501611 is the updated version of KN301611.
Arpc5 (GFP-tagged) - Mouse actin related protein 2/3 complex, subunit 5 (Arpc5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Arpc5 (Myc-DDK-tagged) - Mouse actin related protein 2/3 complex, subunit 5 (Arpc5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Arpc5 (Myc-DDK-tagged) - Mouse actin related protein 2/3 complex, subunit 5 (Arpc5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Arpc5 (mGFP-tagged) - Mouse actin related protein 2/3 complex, subunit 5 (Arpc5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Arpc5 (GFP-tagged) - Mouse actin related protein 2/3 complex, subunit 5 (Arpc5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ARPC5 (mGFP-tagged) - Human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ARPC5 (Myc-DDK tagged) - Homo sapiens actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARPC5 (GFP-tagged) - Homo sapiens actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Arpc5 (Myc-DDK-tagged ORF) - Rat actin related protein 2/3 complex, subunit 5 (Arpc5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Arpc5 (Myc-DDK-tagged ORF) - Rat actin related protein 2/3 complex, subunit 5 (Arpc5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Arpc5 (Myc-DDK-tagged ORF) - Rat actin related protein 2/3 complex, subunit 5 (Arpc5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Arpc5 (mGFP-tagged ORF) - Rat actin related protein 2/3 complex, subunit 5 (Arpc5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Arpc5 (GFP-tagged ORF) - Rat actin related protein 2/3 complex, subunit 5 (Arpc5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ARPC5 (untagged)-Human actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Arpc5 (untagged) - Mouse actin related protein 2/3 complex, subunit 5 (Arpc5), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ARPC5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-Arpc5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Arpc5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Arpc5. Synthetic peptide located within the following region: VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN |
ARPC5 / ARC16 (1-151, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
ARPC5 / ARC16 (1-151, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
ARPC5 CRISPRa kit - CRISPR gene activation of human actin related protein 2/3 complex subunit 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Arpc5 CRISPRa kit - CRISPR gene activation of mouse actin related protein 2/3 complex, subunit 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ARPC5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ARPC5
qPCR primer pairs and template standards against Mus musculus gene Arpc5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Arpc5
ARPC5 MS Standard C13 and N15-labeled recombinant protein (NP_005708)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Arpc5 (untagged ORF) - Rat actin related protein 2/3 complex, subunit 5 (Arpc5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of actin related protein 2/3 complex subunit 5 16kDa (ARPC5) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ARPC5 (untagged) - Homo sapiens actin related protein 2/3 complex, subunit 5, 16kDa (ARPC5), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Arpc5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Arpc5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
p16-ARC/ARC16/ARPC5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human p16-ARC/ARC16/p16-ARC/ARC16/ARPC5 (NP_001257368.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
Transient overexpression of ARPC5 (NM_005717) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARPC5 (NM_001270439) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ARPC5 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ARPC5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ARPC5