Products

View as table Download

Rabbit Polyclonal Anti-FERMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FERMT2 Antibody is: synthetic peptide directed towards the C-terminal region of Human FERMT2. Synthetic peptide located within the following region: TSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGM

FERMT2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 380-550 of human FERMT2 (NP_006823.1).
Modifications Unmodified