Products

View as table Download

Rabbit Polyclonal Anti-GABA(A) ?2 (extracellular)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)RKRWTGHLETSKPSH, corresponding to amino acid residues 51-65 of rat GABA(A) ?2. Extracellular, N-terminus.

Rabbit Polyclonal Anti-GABRR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY

GABRR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRR2

GABRR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human GABRR2 (NP_002034.3).
Modifications Unmodified