GLUD1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Immunogen | Glutamate Dehydrogenase (Bovine Liver). |
GLUD1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Immunogen | Glutamate Dehydrogenase (Bovine Liver). |
GLUD1 rabbit polyclonal antibody, Biotin
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Conjugation | Biotin |
Immunogen | Glutamate Dehydrogenase (Bovine Liver). |
GLUD1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Immunogen | L-Glutamate Dehydrogenase isolated and purified from Bovine Liver. |
GLUD1 Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2. |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
Applications | IHC |
Reactivities | Bovine, Human |
Conjugation | Unconjugated |
Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
GLUD1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GLUD1 |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
GLUD1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GLUD1 |
GLUD1 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 54-240 of human GLUD1 (NP_005262.1). |
Modifications | Unmodified |