Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit anti-GPC3 Polyclonal Antibody
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GPC3 |
Rabbit polyclonal Anti-GPC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL |
Glypican 3 (GPC3) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 464-494 amino acids from the C-terminal region of human GPC3 |
Glypican 3 (GPC3) Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human Glypican 3 (Glypican 3 (GPC3)) (NP_004475.1). |
| Modifications | Unmodified |
Glypican 3 (GPC3) Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human Glypican 3 (Glypican 3 (GPC3)) (NP_004475.1). |
| Modifications | Unmodified |
Glypican 3 (GPC3) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human Glypican 3 (Glypican 3 (GPC3)) (NP_004475.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GPC3
Clonalities
- Polyclonal