Products

View as table Download

KCNH7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNH7

KCNH7 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 58~87 amino acids from the N-terminal region of human KCNH7

Rabbit polyclonal Anti-KV11.3 (erg3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CPEFLDLEKSKLKSKE, corresponding to amino acid residues 1108-1123 of rat Kv11.3. Intracellular, C-terminal part.

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the middle region of human KCNH7. Synthetic peptide located within the following region: LEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYVH

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the N terminal of human KCNH7. Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV

KCNH7 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNH7

KCNH7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNH7

KCNH7 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human KCNH7 (NP_775185.1).
Modifications Unmodified