Germany
Japan
United Kingdom
China
KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCNH7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407714 is the updated version of KN207714.
Kcnh7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508642 is the updated version of KN308642.
Kcnh7 (GFP-tagged) - Mouse potassium voltage-gated channel subfamily H (eag-related) member 7 (Kcnh7), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcnh7 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Kcnh7 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnh7 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Kcnh7 (mGFP-tagged) - Mouse potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Kcnh7 (GFP-tagged) - Mouse potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of KCNH7 (mGFP-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNH7 (mGFP-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNH7 (Myc-DDK tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, KCNH7 (mGFP-tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
KCNH7 (GFP-tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCNH7 (GFP-tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Kcnh7 (Myc-DDK-tagged ORF) - Rat potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
KCNH7 (untagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of KCNH7 (NM_033272) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
KCNH7 (untagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-KCNH7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the middle region of human KCNH7. Synthetic peptide located within the following region: LEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYVH |
Rabbit Polyclonal Anti-KCNH7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the N terminal of human KCNH7. Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV |
KCNH7 CRISPRa kit - CRISPR gene activation of human potassium voltage-gated channel subfamily H member 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Kcnh7 CRISPRa kit - CRISPR gene activation of mouse potassium voltage-gated channel, subfamily H (eag-related), member 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene KCNH7
KCNH7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Kcnh7 (untagged) - Mouse potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Kcnh7
Kcnh7 (untagged ORF) - Rat potassium voltage-gated channel, subfamily H (eag-related), member 7 (Kcnh7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of potassium voltage-gated channel subfamily H (eag-related) member 7 (KCNH7) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of potassium voltage-gated channel subfamily H (eag-related) member 7 (KCNH7) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
KCNH7 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Kcnh7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Kcnh7 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
KCNH7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNH7 |
KCNH7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human KCNH7 (NP_775185.1). |
| Modifications | Unmodified |
Transient overexpression of KCNH7 (NM_173162) in HEK293T cells paraffin embedded controls for ICC/IHC staining
KCNH7 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
KCNH7 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Kcnh7 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Kcnh7 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- KCNH7