Products

View as table Download

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the N terminal of human OTX1. Synthetic peptide located within the following region: PRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQV

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: HHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASW

OTX1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 86-116 amino acids from the Central region of human OTX1

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the N terminal of human OTX1. Synthetic peptide located within the following region: KINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSES

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the C terminal of human OTX1. Synthetic peptide located within the following region: SGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL

Rabbit Polyclonal Anti-OTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX1 antibody: synthetic peptide directed towards the middle region of human OTX1. Synthetic peptide located within the following region: ISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSY

OTX1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse OTX1

OTX1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OTX1

OTX1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OTX1

OTX1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Otx1

OTX1/2 Rabbit polyclonal Antibody

Applications ChIP, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Otx1/2