Rabbit Polyclonal Anti-PARVB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARVB antibody: synthetic peptide directed towards the N terminal of human PARVB. Synthetic peptide located within the following region: LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV |
Rabbit Polyclonal Anti-PARVB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARVB antibody: synthetic peptide directed towards the C terminal of human PARVB. Synthetic peptide located within the following region: HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE |
PARVB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PARVB (NP_037459.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China