Products

cDNA Clones (35)
Antibodies (33)
Proteins (16)
RNAi (12)
Gene Expression (7)
Jump to Filters
View as table Download
PARVB (NM_001003828) Human Tagged ORF Clone
RC218650

USD 420.00

In Stock

PARVB (Myc-DDK-tagged)-Human parvin, beta (PARVB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PARVB (NM_013327) Human Tagged ORF Clone
RC208490

USD 420.00

In Stock

PARVB (Myc-DDK-tagged)-Human parvin, beta (PARVB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PARVB (NM_013327) Human Tagged ORF Clone
RG208490

USD 460.00

In Stock

PARVB (GFP-tagged) - Human parvin, beta (PARVB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PARVB Human Gene Knockout Kit (CRISPR)
KN408490

USD 1,290.00

2 Weeks

PARVB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN408490 is the updated version of KN208490.
Parvb Mouse Gene Knockout Kit (CRISPR)
KN512834

USD 1,290.00

2 Weeks

Parvb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512834 is the updated version of KN312834.
Parvb (NM_133167) Mouse Tagged ORF Clone
MG227262

USD 420.00

3 Weeks

Parvb (GFP-tagged) - Mouse parvin beta (Parvb), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvb (NM_133167) Mouse Tagged ORF Clone
MR227262

USD 380.00

4 Weeks

Parvb (Myc-DDK-tagged) - Mouse parvin, beta (Parvb)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvb (NM_133167) Mouse Tagged ORF Clone
MR227262L3

USD 580.00

3 Weeks

Lenti ORF clone of Parvb (Myc-DDK-tagged) - Mouse parvin, beta (Parvb)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parvb (NM_133167) Mouse Tagged ORF Clone
MR227262L4

USD 580.00

3 Weeks

Lenti ORF clone of Parvb (mGFP-tagged) - Mouse parvin, beta (Parvb)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB (NM_013327) Human Tagged ORF Clone
RC208490L3

USD 620.00

3 Weeks

Lenti ORF clone of Human parvin, beta (PARVB), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB (NM_013327) Human Tagged ORF Clone Lentiviral Particle
RC208490L3V

USD 820.00

6 Weeks

Lenti ORF particles, PARVB (Myc-DDK tagged) - Human parvin, beta (PARVB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB (NM_013327) Human Tagged ORF Clone
RC208490L4

USD 620.00

3 Weeks

Lenti ORF clone of Human parvin, beta (PARVB), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB (NM_013327) Human Tagged ORF Clone Lentiviral Particle
RC208490L4V

USD 820.00

6 Weeks

Lenti ORF particles, PARVB (mGFP-tagged) - Human parvin, beta (PARVB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB (NM_001003828) Human Tagged ORF Clone
RC218650L3

USD 620.00

3 Weeks

Lenti-ORF clone of PARVB (Myc-DDK-tagged)-Human parvin, beta (PARVB), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB (NM_001003828) Human Tagged ORF Clone
RC218650L4

USD 620.00

3 Weeks

Lenti-ORF clone of PARVB (mGFP-tagged)-Human parvin, beta (PARVB), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB (NM_001243386) Human Tagged ORF Clone
RC233664

USD 420.00

3 Weeks

PARVB (Myc-DDK tagged) - Homo sapiens parvin, beta (PARVB), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PARVB (NM_001243385) Human Tagged ORF Clone
RC233776

USD 420.00

3 Weeks

PARVB (Myc-DDK tagged) - Homo sapiens parvin, beta (PARVB), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PARVB (NM_001003828) Human Tagged ORF Clone
RG218650

USD 460.00

3 Weeks

PARVB (GFP-tagged) - Human parvin, beta (PARVB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PARVB (NM_001243386) Human Tagged ORF Clone
RG233664

USD 460.00

3 Weeks

PARVB (GFP-tagged) - Homo sapiens parvin, beta (PARVB), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PARVB (NM_001243385) Human Tagged ORF Clone
RG233776

USD 460.00

3 Weeks

PARVB (GFP-tagged) - Homo sapiens parvin, beta (PARVB), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvb (NM_001134780) Rat Tagged ORF Clone
RR207031

USD 420.00

4 Weeks

Parvb (Myc-DDK-tagged ORF) - Rat parvin, beta (Parvb), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvb (NM_001134780) Rat Tagged ORF Clone
RR207031L3

USD 640.00

8 Weeks

Lenti ORF clone of Parvb (Myc-DDK-tagged ORF) - Rat parvin, beta (Parvb), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parvb (NM_001134780) Rat Tagged ORF Clone
RR207031L4

USD 700.00

8 Weeks

Lenti ORF clone of Parvb (mGFP-tagged ORF) - Rat parvin, beta (Parvb), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PARVB Human shRNA Plasmid Kit (Locus ID 29780)
TR310602

USD 715.00

In Stock

PARVB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
PARVB (NM_013327) Human Over-expression Lysate
LC415629

USD 121.00

In Stock

PARVB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PARVB (NM_001003828) Human Over-expression Lysate
LY424026

USD 396.00

In Stock

Transient overexpression lysate of parvin, beta (PARVB), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PARVB (NM_013327) Human Untagged Clone
SC324009

USD 760.00

In Stock

PARVB (untagged)-Human parvin, beta (PARVB), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC324009 is the updated version of SC115283.
PARVB (NM_013327) Human Over-expression Lysate
LY415629

USD 396.00

5 Days

Transient overexpression lysate of parvin, beta (PARVB), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PARVB Rabbit Polyclonal Antibody
TA338970

USD 375.00

5 Days

Rabbit Polyclonal Anti-PARVB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARVB antibody: synthetic peptide directed towards the N terminal of human PARVB. Synthetic peptide located within the following region: LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV
PARVB Rabbit Polyclonal Antibody
TA338971

USD 375.00

5 Days

Rabbit Polyclonal Anti-PARVB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARVB antibody: synthetic peptide directed towards the C terminal of human PARVB. Synthetic peptide located within the following region: HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE
PARVB Mouse Monoclonal Antibody [Clone ID: OTI2B4]
CF505677

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARVB mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARVB Mouse Monoclonal Antibody [Clone ID: OTI2H1]
CF505678

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARVB mouse monoclonal antibody,clone OTI2H1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARVB Mouse Monoclonal Antibody [Clone ID: OTI1B9]
CF505679

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARVB mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARVB Mouse Monoclonal Antibody [Clone ID: OTI1B7]
CF505695

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARVB mouse monoclonal antibody,clone OTI1B7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARVB Mouse Monoclonal Antibody [Clone ID: OTI2H9]
CF505714

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARVB mouse monoclonal antibody,clone OTI2H9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PARVB Mouse Monoclonal Antibody [Clone ID: OTI3G1]
CF505715

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PARVB mouse monoclonal antibody,clone OTI3G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human PARVB activation kit by CRISPRa
GA109267

USD 1,290.00

2 Weeks

PARVB CRISPRa kit - CRISPR gene activation of human parvin beta

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Parvb activation kit by CRISPRa
GA212584

USD 1,290.00

2 Weeks

Parvb CRISPRa kit - CRISPR gene activation of mouse parvin, beta

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PARVB Human qPCR Template Standard (NM_013327)
HK210111

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PARVB

Application Plasmid of exact quantity for transcript copy number calculation
PARVB Human qPCR Primer Pair (NM_013327)
HP225727

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PARVB

PARVB (NM_001003828) Human Over-expression Lysate
LC424026

USD 121.00

2 Weeks

PARVB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvb (NM_133167) Mouse Untagged Clone
MC212332

USD 420.00

4 Weeks

Parvb (untagged) - Mouse parvin, beta (Parvb), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Parvb Mouse qPCR Primer Pair (NM_133167)
MP210616

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Parvb