Products

Jump to Filters
View as table Download
PDE1A Rabbit Polyclonal Antibody
TA308379

USD 415.00

5 Days

Rabbit Polyclonal antibody to PDE1A (phosphodiesterase 1A, calmodulin-dependent)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 212 and 535 of PDE1A (Uniprot ID#P54750)
PDE1A Goat Polyclonal Antibody
TA311317

USD 375.00

5 Days

Goat Anti-PDE1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLHKNSEDLVNAE, from the C Terminus of the protein sequence according to NP_005010.2.
PDE1A Rabbit Polyclonal Antibody
TA335729

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDE1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET
PDE1A Rabbit Polyclonal Antibody
TA363737

USD 360.00

5 Days

PDE1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PDE1A
PDE1A Rabbit Polyclonal Antibody
TA379728

USD 220.00

3 Weeks

PDE1A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 446-545 of human PDE1A (NP_005010.2).
Modifications Unmodified