Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal anti-PTGER3 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PTGER3. |
Goat Polyclonal Antibody against PTGER3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KLLREPCSVQLS, from the C Terminus of the protein sequence according to NP_000948.2; NP_942005.2; NP_942006.1. |
Rabbit Polyclonal Anti-PTGER3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL |
Rabbit Polyclonal Anti-PTGER3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV |
Rabbit Polyclonal Anti-PTGER3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the C terminal of human PTGER3. Synthetic peptide located within the following region: LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER |
Rabbit Polyclonal Anti-PTGER3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE |
PTGER3 (Cytoplasmic Domain) rabbit polyclonal antibody, Immunoaffinity purified
| Applications | IHC |
| Reactivities | Human, Bovine, Pig, Horse, Monkey (Predicted: Rat, Bat, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 16 amino acid peptide from 1st cytoplasmic domain of human PTGER3 / EP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Bovine, Horse, Pig (100%); Gorilla, Rat, Elephant, Bat, Rabbit (94%); Mouse, Panda (88%). |
Rabbit Polyclonal Anti-PTGER3 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PTGER3 / EP3 antibody was raised against synthetic 17 amino acid peptide from 1st cytoplasmic domain of human PTGER3 / EP3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bat (100%); Mouse (94%); Xenopus (88%); Bovine, Pig, Opossum (82%). |
PGE receptor EP3 (PTGER3) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of human PGE receptor EP3 (PTGER3) (NP_942009.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PTGER3
Clonalities
- Polyclonal