PTGER3 Rabbit Polyclonal Antibody

CAT#: TA334750

Rabbit Polyclonal Anti-PTGER3 Antibody

Product Images

WB Suggested Anti-PTGER3 Antibody Titration: 2.4 ug/ml; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: PTGER3; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the C terminal of human PTGER3. Synthetic peptide located within the following region: LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: prostaglandin E receptor 3
• Database Link:
  NP_000948
  Entrez Gene 5733 Human
  UniProt ID P43115
• Background: PTGER3 is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli.
• Synonyms: EP3; EP3-I; EP3-II; EP3-III; EP3-IV; EP3e; MGC27302; MGC141828; MGC141829
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transcription Factors, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction